Trang web này sẽ có chức năng hạn chế trong khi chúng tôi trải qua bảo trì để cải thiện trải nghiệm của bạn. Nếu một bài viết không giải quyết được vấn đề của bạn và bạn muốn đặt câu hỏi, chúng tôi có cộng đồng hỗ trợ của chúng tôi đang chờ để giúp bạn tại @FirefoxSupport trên Twitter và /r/firefox trên Reddit.

Tìm kiếm hỗ trợ

Tránh các lừa đảo về hỗ trợ. Chúng tôi sẽ không bao giờ yêu cầu bạn gọi hoặc nhắn tin đến số điện thoại hoặc chia sẻ thông tin cá nhân. Vui lòng báo cáo hoạt động đáng ngờ bằng cách sử dụng tùy chọn "Báo cáo lạm dụng".

Tìm hiểu thêm

Sending Emails from Thunderbird to Gmail

  • 1 trả lời
  • 0 gặp vấn đề này
  • 1 lượt xem
  • Trả lời mới nhất được viết bởi christ1

more options

Greetings. I am having trouble sending email from my account which is through Thunderbird to those individuals who have gmail accounts. Please advise. Thanks you.

Here is an example of the error message:

The original message was received at Thu, 6 Jul 2023 11:09:51 -0400 from 108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198]

  ----- The following addresses had permanent fatal errors -----

<mattmckeegan25444@gmail.com>

   (reason: 550-5.7.26 This mail is unauthenticated, which poses a security risk to the)
  ----- Transcript of session follows -----

... while talking to gmail-smtp-in.l.google.com.: >>> DATA <<< 550-5.7.26 This mail is unauthenticated, which poses a security risk to the <<< 550-5.7.26 sender and Gmail users, and has been blocked. The sender must <<< 550-5.7.26 authenticate with at least one of SPF or DKIM. For this message, <<< 550-5.7.26 DKIM checks did not pass and SPF check for [mckeeganassociates.com] <<< 550-5.7.26 did not pass with ip: [69.156.243.30]. The sender should visit <<< 550-5.7.26 https://support.google.com/mail/answer/81126#authentication for <<< 550 5.7.26 instructions on setting up authentication. 70-20020a1f1749000000b0047161e5bb9csi152971vkx.43 - gsmtp 554 5.0.0 Service unavailable


Reporting-MTA: dns; mail290c9.megamailservers.com Received-From-MTA: DNS; 108-204-192-198.lightspeed.mmphtn.sbcglobal.net Arrival-Date: Thu, 6 Jul 2023 11:09:51 -0400

Final-Recipient: RFC822; mattmckeegan25444@gmail.com Action: failed Status: 5.7.26 Remote-MTA: DNS; gmail-smtp-in.l.google.com Diagnostic-Code: @gmail.com; 550-5.7.26 This mail is unauthenticated, which poses a security risk to the Last-Attempt-Date: Thu, 6 Jul 2023 11:09:58 -0400


X-POP-User: matt@mckeeganassociates.com Feedback-ID:matt@mckeeganas Authentication-Results: MTA-69.156.243.30; dkim=none; spf=none (MTA-69.156.243.30: domain of matt@mckeeganassociates.com has no SPF policy when checking 108.204.192.198) smtp.mailfrom=matt@mckeeganassociates.com; dmarc=none X-Envelope-From: matt@mckeeganassociates.com Return-Path: <matt@mckeeganassociates.com> Received: from [192.168.1.80] (108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198]) by mail290c9.megamailservers.com (8.14.9/8.13.1) with ESMTP id 366F9lYW022129 for <mattmckeegan25444@gmail.com>; Thu, 6 Jul 2023 11:09:51 -0400 Content-Type: multipart/alternative;

boundary="------------2AMDNET0HgJUeo3qv9elOmlc"

Message-ID: <0641493e-e69a-c9cd-868d-2edd1e138bf1@mckeeganassociates.com> Date: Thu, 6 Jul 2023 10:09:48 -0500 MIME-Version: 1.0 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:102.0) Gecko/20100101

Thunderbird/102.12.0

Subject: Fwd: Survey - Lone Oak References: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> Content-Language: en-US To: mattmckeegan25444@gmail.com From: Matt McKeegan <matt@mckeeganassociates.com> Organization: McKeegan Associates In-Reply-To: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-Forwarded-Message-Id: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-VADE-SPAMSTATE: clean X-VADE-SPAMSCORE: 0 X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudelgdekhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpqfgfvfdpgffpggdqvedvnecuuegrihhlohhuthemuceftddunecunecujfgurheptgfkffggfgfufhfvhfhojgesrgdtreertdefjeenucfhrhhomhepofgrthhtucfotgfmvggvghgrnhcuoehmrghtthesmhgtkhgvvghgrghnrghsshhotghirghtvghsrdgtohhmqeenucggtffrrghtthgvrhhnpeetveetffejleegtdeguddvgeffffevieelkeejgeefgfetkefgudeiudfftdehgfenucfkphepuddtkedrvddtgedrudelvddrudelkeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedutdekrddvtdegrdduledvrdduleekpdhhvghloheplgduledvrdduieekrddurdektdgnpdhmrghilhhfrhhomhepmhgrthhtsehmtghkvggvghgrnhgrshhsohgtihgrthgvshdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehmrghtthhmtghkvggvghgrnhdvheeggeegsehgmhgrihhlrdgtohhm X-CTCH-RefID: 0641493e-e69a-c9cd-868d-2edd1e138bf1@mckeeganassociates.com X-CTCH-VOD: Unknown X-CTCH-Spam: mc_UNKNOWN X-CTCH-Score: 0.000 X-CTCH-Rules: X-CTCH-Flags: 0 X-CTCH-ScoreCust: 0.000 X-Rspamd-Status: No, score=5.40 X-Rspamd-Result: default: False [5.40 / 6.00]; HFILTER_HELO_BADIP(4.50)[192.168.1.80,1]; AUTH_NA(1.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; R_SPF_NA(0.00)[no SPF record]; FREEMAIL_TO(0.00)[gmail.com]; NEURAL_SPAM(0.00)[0.308]; RCVD_COUNT_ZERO(0.00)[0]; R_DKIM_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ARC_NA(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; TO_MATCH_ENVRCPT_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:7018, ipnet:108.192.0.0/10, country:US]; FREEMAIL_ENVRCPT(0.00)[gmail.com]; DMARC_NA(0.00)[mckeeganassociates.com]; TO_DN_NONE(0.00)[]; MID_RHS_MATCH_FROM(0.00)[] X-Origin-Country: US

Greetings. I am having trouble sending email from my account which is through Thunderbird to those individuals who have gmail accounts. Please advise. Thanks you. Here is an example of the error message: The original message was received at Thu, 6 Jul 2023 11:09:51 -0400 from 108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198] ----- The following addresses had permanent fatal errors ----- <mattmckeegan25444@gmail.com> (reason: 550-5.7.26 This mail is unauthenticated, which poses a security risk to the) ----- Transcript of session follows ----- ... while talking to gmail-smtp-in.l.google.com.: >>> DATA <<< 550-5.7.26 This mail is unauthenticated, which poses a security risk to the <<< 550-5.7.26 sender and Gmail users, and has been blocked. The sender must <<< 550-5.7.26 authenticate with at least one of SPF or DKIM. For this message, <<< 550-5.7.26 DKIM checks did not pass and SPF check for [mckeeganassociates.com] <<< 550-5.7.26 did not pass with ip: [69.156.243.30]. The sender should visit <<< 550-5.7.26 https://support.google.com/mail/answer/81126#authentication for <<< 550 5.7.26 instructions on setting up authentication. 70-20020a1f1749000000b0047161e5bb9csi152971vkx.43 - gsmtp 554 5.0.0 Service unavailable Reporting-MTA: dns; mail290c9.megamailservers.com Received-From-MTA: DNS; 108-204-192-198.lightspeed.mmphtn.sbcglobal.net Arrival-Date: Thu, 6 Jul 2023 11:09:51 -0400 Final-Recipient: RFC822; mattmckeegan25444@gmail.com Action: failed Status: 5.7.26 Remote-MTA: DNS; gmail-smtp-in.l.google.com Diagnostic-Code: @gmail.com; 550-5.7.26 This mail is unauthenticated, which poses a security risk to the Last-Attempt-Date: Thu, 6 Jul 2023 11:09:58 -0400 X-POP-User: matt@mckeeganassociates.com Feedback-ID:matt@mckeeganas Authentication-Results: MTA-69.156.243.30; dkim=none; spf=none (MTA-69.156.243.30: domain of matt@mckeeganassociates.com has no SPF policy when checking 108.204.192.198) smtp.mailfrom=matt@mckeeganassociates.com; dmarc=none X-Envelope-From: matt@mckeeganassociates.com Return-Path: <matt@mckeeganassociates.com> Received: from [192.168.1.80] (108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198]) by mail290c9.megamailservers.com (8.14.9/8.13.1) with ESMTP id 366F9lYW022129 for <mattmckeegan25444@gmail.com>; Thu, 6 Jul 2023 11:09:51 -0400 Content-Type: multipart/alternative; boundary="------------2AMDNET0HgJUeo3qv9elOmlc" Message-ID: <0641493e-e69a-c9cd-868d-2edd1e138bf1@mckeeganassociates.com> Date: Thu, 6 Jul 2023 10:09:48 -0500 MIME-Version: 1.0 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:102.0) Gecko/20100101 Thunderbird/102.12.0 Subject: Fwd: Survey - Lone Oak References: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> Content-Language: en-US To: mattmckeegan25444@gmail.com From: Matt McKeegan <matt@mckeeganassociates.com> Organization: McKeegan Associates In-Reply-To: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-Forwarded-Message-Id: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-VADE-SPAMSTATE: clean X-VADE-SPAMSCORE: 0 X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudelgdekhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpqfgfvfdpgffpggdqvedvnecuuegrihhlohhuthemuceftddunecunecujfgurheptgfkffggfgfufhfvhfhojgesrgdtreertdefjeenucfhrhhomhepofgrthhtucfotgfmvggvghgrnhcuoehmrghtthesmhgtkhgvvghgrghnrghsshhotghirghtvghsrdgtohhmqeenucggtffrrghtthgvrhhnpeetveetffejleegtdeguddvgeffffevieelkeejgeefgfetkefgudeiudfftdehgfenucfkphepuddtkedrvddtgedrudelvddrudelkeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedutdekrddvtdegrdduledvrdduleekpdhhvghloheplgduledvrdduieekrddurdektdgnpdhmrghilhhfrhhomhepmhgrthhtsehmtghkvggvghgrnhgrshhsohgtihgrthgvshdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehmrghtthhmtghkvggvghgrnhdvheeggeegsehgmhgrihhlrdgtohhm X-CTCH-RefID: 0641493e-e69a-c9cd-868d-2edd1e138bf1@mckeeganassociates.com X-CTCH-VOD: Unknown X-CTCH-Spam: mc_UNKNOWN X-CTCH-Score: 0.000 X-CTCH-Rules: X-CTCH-Flags: 0 X-CTCH-ScoreCust: 0.000 X-Rspamd-Status: No, score=5.40 X-Rspamd-Result: default: False [5.40 / 6.00]; HFILTER_HELO_BADIP(4.50)[192.168.1.80,1]; AUTH_NA(1.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; R_SPF_NA(0.00)[no SPF record]; FREEMAIL_TO(0.00)[gmail.com]; NEURAL_SPAM(0.00)[0.308]; RCVD_COUNT_ZERO(0.00)[0]; R_DKIM_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ARC_NA(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; TO_MATCH_ENVRCPT_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:7018, ipnet:108.192.0.0/10, country:US]; FREEMAIL_ENVRCPT(0.00)[gmail.com]; DMARC_NA(0.00)[mckeeganassociates.com]; TO_DN_NONE(0.00)[]; MID_RHS_MATCH_FROM(0.00)[] X-Origin-Country: US

Tất cả các câu trả lời (1)

more options

Your email provider neither supports SPF nor DKIM. Talk to your email provider, and pass on the link with the instructions Google provided in the error message.